Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for oceanic1986 221. oceanic1986 Lv 1 1 pt. 8,498
  2. Avatar for thaddeusmulder 222. thaddeusmulder Lv 1 1 pt. 8,492
  3. Avatar for Rachel Nugent 223. Rachel Nugent Lv 1 1 pt. 8,484
  4. Avatar for Pless 224. Pless Lv 1 1 pt. 8,467
  5. Avatar for GrayFix 225. GrayFix Lv 1 1 pt. 8,466
  6. Avatar for girltano 226. girltano Lv 1 1 pt. 8,460
  7. Avatar for alejoduquev 227. alejoduquev Lv 1 1 pt. 8,436
  8. Avatar for LukaTheWizard 228. LukaTheWizard Lv 1 1 pt. 8,414
  9. Avatar for Verne 229. Verne Lv 1 1 pt. 8,401
  10. Avatar for Thebatman012 230. Thebatman012 Lv 1 1 pt. 8,401

Comments