Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for JXPZ 231. JXPZ Lv 1 1 pt. 8,359
  2. Avatar for davidmring 232. davidmring Lv 1 1 pt. 8,358
  3. Avatar for pachkulya 233. pachkulya Lv 1 1 pt. 8,319
  4. Avatar for Auntecedent 234. Auntecedent Lv 1 1 pt. 8,305
  5. Avatar for Simek 235. Simek Lv 1 1 pt. 8,262
  6. Avatar for zhaobinxu 236. zhaobinxu Lv 1 1 pt. 8,155
  7. Avatar for Personifire 237. Personifire Lv 1 1 pt. 8,094
  8. Avatar for zkm 238. zkm Lv 1 1 pt. 8,007
  9. Avatar for VespucciDude 239. VespucciDude Lv 1 1 pt. 7,996
  10. Avatar for z13z 240. z13z Lv 1 1 pt. 7,996

Comments