Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for gabalele 120 241. gabalele 120 Lv 1 1 pt. 7,972
  2. Avatar for isaa6 242. isaa6 Lv 1 1 pt. 7,922
  3. Avatar for melissaop 243. melissaop Lv 1 1 pt. 7,878
  4. Avatar for SMT1998 244. SMT1998 Lv 1 1 pt. 7,874
  5. Avatar for dzikiplankton 245. dzikiplankton Lv 1 1 pt. 7,843
  6. Avatar for milimani 246. milimani Lv 1 1 pt. 7,808
  7. Avatar for kuuichi09 247. kuuichi09 Lv 1 1 pt. 7,797
  8. Avatar for ScientistGamer 248. ScientistGamer Lv 1 1 pt. 7,688
  9. Avatar for Bullardben 249. Bullardben Lv 1 1 pt. 7,596
  10. Avatar for csowens0 250. csowens0 Lv 1 1 pt. 7,590

Comments