Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for g_b 31. g_b Lv 1 55 pts. 10,108
  2. Avatar for actiasluna 32. actiasluna Lv 1 54 pts. 10,103
  3. Avatar for Deleted player 33. Deleted player 53 pts. 10,099
  4. Avatar for O Seki To 34. O Seki To Lv 1 52 pts. 10,096
  5. Avatar for christioanchauvin 35. christioanchauvin Lv 1 51 pts. 10,095
  6. Avatar for grogar7 36. grogar7 Lv 1 50 pts. 10,095
  7. Avatar for mimi 37. mimi Lv 1 49 pts. 10,093
  8. Avatar for tallguy-13088 38. tallguy-13088 Lv 1 48 pts. 10,085
  9. Avatar for reefyrob 39. reefyrob Lv 1 47 pts. 10,075
  10. Avatar for pmdpmd 40. pmdpmd Lv 1 46 pts. 10,069

Comments