Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  6. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  7. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  8. Avatar for Deleted group 19. Deleted group pts. 8,608
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539

  1. Avatar for hansvandenhof 51. hansvandenhof Lv 1 36 pts. 9,957
  2. Avatar for stomjoh 52. stomjoh Lv 1 35 pts. 9,955
  3. Avatar for isaksson 53. isaksson Lv 1 34 pts. 9,939
  4. Avatar for Glen B 54. Glen B Lv 1 33 pts. 9,931
  5. Avatar for strong_base 55. strong_base Lv 1 33 pts. 9,928
  6. Avatar for WarpSpeed 56. WarpSpeed Lv 1 32 pts. 9,908
  7. Avatar for jobo0502 57. jobo0502 Lv 1 31 pts. 9,908
  8. Avatar for greepski 58. greepski Lv 1 30 pts. 9,906
  9. Avatar for shettler 59. shettler Lv 1 30 pts. 9,888
  10. Avatar for caglar 60. caglar Lv 1 29 pts. 9,886

Comments