Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 7,308
  1. Avatar for Timo van der Laan
    1. Timo van der Laan Lv 1
    100 pts. 10,232
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 99 pts. 10,224
  3. Avatar for Blipperman 3. Blipperman Lv 1 97 pts. 10,205
  4. Avatar for viosca 4. viosca Lv 1 95 pts. 10,199
  5. Avatar for gmn 5. gmn Lv 1 93 pts. 10,189
  6. Avatar for pauldunn 6. pauldunn Lv 1 91 pts. 10,189
  7. Avatar for johnmitch 7. johnmitch Lv 1 90 pts. 10,188
  8. Avatar for KarenCH 8. KarenCH Lv 1 88 pts. 10,185
  9. Avatar for smilingone 9. smilingone Lv 1 86 pts. 10,182
  10. Avatar for uhuuhu 10. uhuuhu Lv 1 85 pts. 10,178

Comments