Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,241
  2. Avatar for Void Crushers 2. Void Crushers 78 pts. 10,232
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,209
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,205
  5. Avatar for Go Science 5. Go Science 33 pts. 10,197
  6. Avatar for Contenders 6. Contenders 24 pts. 10,141
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 10,124
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 10,097
  9. Avatar for Deleted group 9. Deleted group pts. 10,066
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 10,022
  1. Avatar for Paulo Roque 21. Paulo Roque Lv 1 3 pts. 10,191
  2. Avatar for alwen 22. alwen Lv 1 2 pts. 10,169
  3. Avatar for Bruno Kestemont 23. Bruno Kestemont Lv 1 2 pts. 10,162
  4. Avatar for dettingen 24. dettingen Lv 1 1 pt. 10,158
  5. Avatar for hansvandenhof 25. hansvandenhof Lv 1 1 pt. 10,153
  6. Avatar for lamoille 26. lamoille Lv 1 1 pt. 10,144
  7. Avatar for gitwut 27. gitwut Lv 1 1 pt. 10,140
  8. Avatar for phi16 28. phi16 Lv 1 1 pt. 10,139
  9. Avatar for TomTaylor 29. TomTaylor Lv 1 1 pt. 10,134
  10. Avatar for jamiexq 30. jamiexq Lv 1 1 pt. 10,133

Comments