Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,241
  2. Avatar for Void Crushers 2. Void Crushers 78 pts. 10,232
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,209
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,205
  5. Avatar for Go Science 5. Go Science 33 pts. 10,197
  6. Avatar for Contenders 6. Contenders 24 pts. 10,141
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 10,124
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 10,097
  9. Avatar for Deleted group 9. Deleted group pts. 10,066
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 10,022
  1. Avatar for ncameron 191. ncameron Lv 1 1 pt. 8,653
  2. Avatar for Akatosh 192. Akatosh Lv 1 1 pt. 8,650
  3. Avatar for Rhyslarn 193. Rhyslarn Lv 1 1 pt. 8,649
  4. Avatar for cnhrcolemam 194. cnhrcolemam Lv 1 1 pt. 8,648
  5. Avatar for Graham MF 195. Graham MF Lv 1 1 pt. 8,646
  6. Avatar for MatthewAcosta 196. MatthewAcosta Lv 1 1 pt. 8,644
  7. Avatar for Radeodem8 197. Radeodem8 Lv 1 1 pt. 8,642
  8. Avatar for pandabearsecond 198. pandabearsecond Lv 1 1 pt. 8,640
  9. Avatar for SergiRoda 199. SergiRoda Lv 1 1 pt. 8,636
  10. Avatar for trebach 200. trebach Lv 1 1 pt. 8,634

Comments