Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,241
  2. Avatar for Void Crushers 2. Void Crushers 78 pts. 10,232
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,209
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,205
  5. Avatar for Go Science 5. Go Science 33 pts. 10,197
  6. Avatar for Contenders 6. Contenders 24 pts. 10,141
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 10,124
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 10,097
  9. Avatar for Deleted group 9. Deleted group pts. 10,066
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 10,022
  1. Avatar for panzerbjorn 251. panzerbjorn Lv 1 1 pt. 7,559
  2. Avatar for Atombryan 252. Atombryan Lv 1 1 pt. 7,427
  3. Avatar for jflat06 253. jflat06 Lv 1 1 pt. 7,308
  4. Avatar for ImASushiRoll 254. ImASushiRoll Lv 1 1 pt. 7,291
  5. Avatar for Sam Aron 255. Sam Aron Lv 1 1 pt. 7,264
  6. Avatar for nikolag6 256. nikolag6 Lv 1 1 pt. 7,183
  7. Avatar for wojak902 257. wojak902 Lv 1 1 pt. 6,905
  8. Avatar for faith_pladsen 258. faith_pladsen Lv 1 1 pt. 6,902
  9. Avatar for bkoep 259. bkoep Lv 1 1 pt. 6,902
  10. Avatar for Jon_Temple 260. Jon_Temple Lv 1 1 pt. 6,902

Comments