Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for reefyrob 41. reefyrob Lv 1 43 pts. 9,397
  2. Avatar for diamond_dust 42. diamond_dust Lv 1 42 pts. 9,386
  3. Avatar for sheerbliss 43. sheerbliss Lv 1 41 pts. 9,383
  4. Avatar for georg137 44. georg137 Lv 1 40 pts. 9,377
  5. Avatar for Anfinsen_slept_here 45. Anfinsen_slept_here Lv 1 39 pts. 9,372
  6. Avatar for pvc78 46. pvc78 Lv 1 39 pts. 9,369
  7. Avatar for pmdpmd 47. pmdpmd Lv 1 38 pts. 9,362
  8. Avatar for hpaege 48. hpaege Lv 1 37 pts. 9,359
  9. Avatar for weitzen 49. weitzen Lv 1 36 pts. 9,358
  10. Avatar for Bushman 50. Bushman Lv 1 35 pts. 9,357

Comments