Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,639
  2. Avatar for Go Science 2. Go Science 78 pts. 9,603
  3. Avatar for Contenders 3. Contenders 60 pts. 9,575
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,570
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,551
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,495
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,473
  8. Avatar for Deleted group 8. Deleted group pts. 9,464
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,438
  10. Avatar for Deleted group 10. Deleted group pts. 9,372
  1. Avatar for reefyrob 41. reefyrob Lv 1 43 pts. 9,397
  2. Avatar for diamond_dust 42. diamond_dust Lv 1 42 pts. 9,386
  3. Avatar for sheerbliss 43. sheerbliss Lv 1 41 pts. 9,383
  4. Avatar for georg137 44. georg137 Lv 1 40 pts. 9,377
  5. Avatar for Anfinsen_slept_here 45. Anfinsen_slept_here Lv 1 39 pts. 9,372
  6. Avatar for pvc78 46. pvc78 Lv 1 39 pts. 9,369
  7. Avatar for pmdpmd 47. pmdpmd Lv 1 38 pts. 9,362
  8. Avatar for hpaege 48. hpaege Lv 1 37 pts. 9,359
  9. Avatar for weitzen 49. weitzen Lv 1 36 pts. 9,358
  10. Avatar for Bushman 50. Bushman Lv 1 35 pts. 9,357

Comments