Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,639
  2. Avatar for Go Science 2. Go Science 78 pts. 9,603
  3. Avatar for Contenders 3. Contenders 60 pts. 9,575
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,570
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,551
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,495
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,473
  8. Avatar for Deleted group 8. Deleted group pts. 9,464
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,438
  10. Avatar for Deleted group 10. Deleted group pts. 9,372
  1. Avatar for aznarog 51. aznarog Lv 1 34 pts. 9,357
  2. Avatar for phi16 52. phi16 Lv 1 33 pts. 9,357
  3. Avatar for Superphosphate 53. Superphosphate Lv 1 33 pts. 9,356
  4. Avatar for tallguy-13088 54. tallguy-13088 Lv 1 32 pts. 9,351
  5. Avatar for johngran 55. johngran Lv 1 31 pts. 9,350
  6. Avatar for Crossed Sticks 56. Crossed Sticks Lv 1 30 pts. 9,349
  7. Avatar for strong_base 57. strong_base Lv 1 30 pts. 9,338
  8. Avatar for jobo0502 58. jobo0502 Lv 1 29 pts. 9,337
  9. Avatar for joremen 59. joremen Lv 1 28 pts. 9,325
  10. Avatar for isaksson 60. isaksson Lv 1 27 pts. 9,323

Comments