Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,698
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,574
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,574
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,489
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,159
  6. Avatar for CureCoin 16. CureCoin 1 pt. 8,022
  7. Avatar for Czech National Team 17. Czech National Team 1 pt. 7,953
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 1 pt. 7,916
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0
  1. Avatar for siah64 181. siah64 Lv 1 1 pt. 8,065
  2. Avatar for pandabearsecond 182. pandabearsecond Lv 1 1 pt. 8,055
  3. Avatar for CaptainCrackers 183. CaptainCrackers Lv 1 1 pt. 8,052
  4. Avatar for Fowardint 184. Fowardint Lv 1 1 pt. 8,049
  5. Avatar for trebach 185. trebach Lv 1 1 pt. 8,048
  6. Avatar for zkm 186. zkm Lv 1 1 pt. 8,036
  7. Avatar for smarthuman 187. smarthuman Lv 1 1 pt. 8,022
  8. Avatar for fiendish_ghoul 188. fiendish_ghoul Lv 1 1 pt. 8,019
  9. Avatar for Vredeman 189. Vredeman Lv 1 1 pt. 8,002
  10. Avatar for Inkedhands 190. Inkedhands Lv 1 1 pt. 7,982

Comments