Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Go Science 100 pts. 8,836
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 8,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 8,834
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 8,811
  5. Avatar for Contenders 5. Contenders 29 pts. 8,807
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 8,799
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 8,793
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 8,790
  9. Avatar for Gargleblasters 9. Gargleblasters 6 pts. 8,786
  10. Avatar for Deleted group 10. Deleted group pts. 8,742

  1. Avatar for siah64 181. siah64 Lv 1 1 pt. 8,065
  2. Avatar for pandabearsecond 182. pandabearsecond Lv 1 1 pt. 8,055
  3. Avatar for CaptainCrackers 183. CaptainCrackers Lv 1 1 pt. 8,052
  4. Avatar for Fowardint 184. Fowardint Lv 1 1 pt. 8,049
  5. Avatar for trebach 185. trebach Lv 1 1 pt. 8,048
  6. Avatar for zkm 186. zkm Lv 1 1 pt. 8,036
  7. Avatar for smarthuman 187. smarthuman Lv 1 1 pt. 8,022
  8. Avatar for fiendish_ghoul 188. fiendish_ghoul Lv 1 1 pt. 8,019
  9. Avatar for Vredeman 189. Vredeman Lv 1 1 pt. 8,002
  10. Avatar for Inkedhands 190. Inkedhands Lv 1 1 pt. 7,982

Comments