Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,698
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,574
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,574
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,489
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,159
  6. Avatar for CureCoin 16. CureCoin 1 pt. 8,022
  7. Avatar for Czech National Team 17. Czech National Team 1 pt. 7,953
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 1 pt. 7,916
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0
  1. Avatar for Aldrovanda 211. Aldrovanda Lv 1 1 pt. 7,383
  2. Avatar for 123Qwerty 212. 123Qwerty Lv 1 1 pt. 7,382
  3. Avatar for kalachastan 213. kalachastan Lv 1 1 pt. 7,361
  4. Avatar for miloPT 214. miloPT Lv 1 1 pt. 7,242
  5. Avatar for china_2272 215. china_2272 Lv 1 1 pt. 6,891
  6. Avatar for Dobby54 216. Dobby54 Lv 1 1 pt. 823
  7. Avatar for dettingen 217. dettingen Lv 1 1 pt. 0
  8. Avatar for packer 218. packer Lv 1 1 pt. 0
  9. Avatar for aspadistra 219. aspadistra Lv 1 1 pt. 0
  10. Avatar for Dempy 220. Dempy Lv 1 1 pt. 0

Comments