Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,836
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 8,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 8,834
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 8,811
  5. Avatar for Contenders 5. Contenders 29 pts. 8,807
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 8,799
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 8,793
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 8,790
  9. Avatar for Gargleblasters 9. Gargleblasters 6 pts. 8,786
  10. Avatar for Deleted group 10. Deleted group pts. 8,742
  1. Avatar for Aldrovanda 211. Aldrovanda Lv 1 1 pt. 7,383
  2. Avatar for 123Qwerty 212. 123Qwerty Lv 1 1 pt. 7,382
  3. Avatar for kalachastan 213. kalachastan Lv 1 1 pt. 7,361
  4. Avatar for miloPT 214. miloPT Lv 1 1 pt. 7,242
  5. Avatar for china_2272 215. china_2272 Lv 1 1 pt. 6,891
  6. Avatar for Dobby54 216. Dobby54 Lv 1 1 pt. 823
  7. Avatar for dettingen 217. dettingen Lv 1 1 pt. 0
  8. Avatar for packer 218. packer Lv 1 1 pt. 0
  9. Avatar for aspadistra 219. aspadistra Lv 1 1 pt. 0
  10. Avatar for Dempy 220. Dempy Lv 1 1 pt. 0

Comments