Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,427
  2. Avatar for bertro 2. bertro Lv 1 98 pts. 9,390
  3. Avatar for tarimo 3. tarimo Lv 1 96 pts. 9,384
  4. Avatar for actiasluna 4. actiasluna Lv 1 93 pts. 9,376
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 91 pts. 9,368
  6. Avatar for pmdpmd 6. pmdpmd Lv 1 89 pts. 9,362
  7. Avatar for johnmitch 7. johnmitch Lv 1 87 pts. 9,360
  8. Avatar for Mark- 8. Mark- Lv 1 84 pts. 9,347
  9. Avatar for gitwut 9. gitwut Lv 1 82 pts. 9,345
  10. Avatar for Skippysk8s 10. Skippysk8s Lv 1 80 pts. 9,339

Comments