1175: Unsolved De-novo Freestyle 62
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- December 23, 2015
- Expires
- Max points
- 100
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV