Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,427
  2. Avatar for bertro 2. bertro Lv 1 98 pts. 9,390
  3. Avatar for tarimo 3. tarimo Lv 1 96 pts. 9,384
  4. Avatar for actiasluna 4. actiasluna Lv 1 93 pts. 9,376
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 91 pts. 9,368
  6. Avatar for pmdpmd 6. pmdpmd Lv 1 89 pts. 9,362
  7. Avatar for johnmitch 7. johnmitch Lv 1 87 pts. 9,360
  8. Avatar for Mark- 8. Mark- Lv 1 84 pts. 9,347
  9. Avatar for gitwut 9. gitwut Lv 1 82 pts. 9,345
  10. Avatar for Skippysk8s 10. Skippysk8s Lv 1 80 pts. 9,339

Comments