Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,426
  2. Avatar for reefyrob 2. reefyrob Lv 1 89 pts. 9,425
  3. Avatar for bertro 3. bertro Lv 1 79 pts. 9,423
  4. Avatar for LociOiling 4. LociOiling Lv 1 70 pts. 9,418
  5. Avatar for Deleted player 5. Deleted player 62 pts. 9,418
  6. Avatar for Deleted player 6. Deleted player pts. 9,409
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 48 pts. 9,409
  8. Avatar for brgreening 8. brgreening Lv 1 42 pts. 9,393
  9. Avatar for diamond_dust 9. diamond_dust Lv 1 36 pts. 9,387
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 31 pts. 9,385

Comments