Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169

  1. Avatar for gloverd 11. gloverd Lv 1 27 pts. 9,385
  2. Avatar for packer 12. packer Lv 1 23 pts. 9,382
  3. Avatar for pauldunn 13. pauldunn Lv 1 20 pts. 9,381
  4. Avatar for mirp 14. mirp Lv 1 17 pts. 9,378
  5. Avatar for Blipperman 15. Blipperman Lv 1 14 pts. 9,375
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 12 pts. 9,374
  7. Avatar for greepski 17. greepski Lv 1 10 pts. 9,368
  8. Avatar for actiasluna 18. actiasluna Lv 1 9 pts. 9,368
  9. Avatar for TomTaylor 19. TomTaylor Lv 1 7 pts. 9,366
  10. Avatar for gitwut 20. gitwut Lv 1 6 pts. 9,359

Comments