Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169

  1. Avatar for grogar7 31. grogar7 Lv 1 1 pt. 9,292
  2. Avatar for alcor29 32. alcor29 Lv 1 1 pt. 9,286
  3. Avatar for dettingen 33. dettingen Lv 1 1 pt. 9,271
  4. Avatar for Scopper 34. Scopper Lv 1 1 pt. 9,269
  5. Avatar for goastano 35. goastano Lv 1 1 pt. 9,224
  6. Avatar for 01010011111 36. 01010011111 Lv 1 1 pt. 9,219
  7. Avatar for nicobul 37. nicobul Lv 1 1 pt. 9,176
  8. Avatar for O Seki To 38. O Seki To Lv 1 1 pt. 9,176
  9. Avatar for justjustin 39. justjustin Lv 1 1 pt. 9,154
  10. Avatar for ManVsYard 40. ManVsYard Lv 1 1 pt. 9,141

Comments