Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169

  1. Avatar for KarenCH 21. KarenCH Lv 1 60 pts. 9,260
  2. Avatar for mimi 22. mimi Lv 1 59 pts. 9,258
  3. Avatar for mirp 23. mirp Lv 1 57 pts. 9,256
  4. Avatar for steveB 24. steveB Lv 1 55 pts. 9,246
  5. Avatar for weitzen 25. weitzen Lv 1 54 pts. 9,238
  6. Avatar for LociOiling 26. LociOiling Lv 1 53 pts. 9,228
  7. Avatar for justjustin 27. justjustin Lv 1 51 pts. 9,221
  8. Avatar for crpainter 28. crpainter Lv 1 50 pts. 9,213
  9. Avatar for jermainiac 29. jermainiac Lv 1 48 pts. 9,211
  10. Avatar for diamond_dust 30. diamond_dust Lv 1 47 pts. 9,193

Comments