Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169

  1. Avatar for gruener-zwer 191. gruener-zwer Lv 1 1 pt. 5,194
  2. Avatar for DrawDragon 192. DrawDragon Lv 1 1 pt. 4,918
  3. Avatar for aspadistra 193. aspadistra Lv 1 1 pt. 3,057
  4. Avatar for shiftshuffle 194. shiftshuffle Lv 1 1 pt. 347
  5. Avatar for 01010011111 196. 01010011111 Lv 1 1 pt. 0
  6. Avatar for packer 197. packer Lv 1 1 pt. 0
  7. Avatar for greepski 198. greepski Lv 1 1 pt. 0
  8. Avatar for 123Qwerty 199. 123Qwerty Lv 1 1 pt. 0
  9. Avatar for agnairt 200. agnairt Lv 1 1 pt. 0

Comments