Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,170
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,943
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,931
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,710
  6. Avatar for freefolder 16. freefolder 1 pt. 8,653
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,629
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,579
  9. Avatar for CureCoin 19. CureCoin 1 pt. 8,482
  1. Avatar for Vinara 91. Vinara Lv 1 7 pts. 9,013
  2. Avatar for greepski 92. greepski Lv 1 7 pts. 8,998
  3. Avatar for gurch 93. gurch Lv 1 7 pts. 8,998
  4. Avatar for JUMELLE54 94. JUMELLE54 Lv 1 7 pts. 8,997
  5. Avatar for Psych0Active 95. Psych0Active Lv 1 6 pts. 8,996
  6. Avatar for mitarcher 96. mitarcher Lv 1 6 pts. 8,992
  7. Avatar for Deleted player 97. Deleted player pts. 8,990
  8. Avatar for Merf 98. Merf Lv 1 6 pts. 8,988
  9. Avatar for pandapharmd 99. pandapharmd Lv 1 6 pts. 8,983
  10. Avatar for ecali 100. ecali Lv 1 5 pts. 8,969

Comments