Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for Vinara 91. Vinara Lv 1 7 pts. 9,013
  2. Avatar for greepski 92. greepski Lv 1 7 pts. 8,998
  3. Avatar for gurch 93. gurch Lv 1 7 pts. 8,998
  4. Avatar for JUMELLE54 94. JUMELLE54 Lv 1 7 pts. 8,997
  5. Avatar for Psych0Active 95. Psych0Active Lv 1 6 pts. 8,996
  6. Avatar for mitarcher 96. mitarcher Lv 1 6 pts. 8,992
  7. Avatar for Deleted player 97. Deleted player pts. 8,990
  8. Avatar for Merf 98. Merf Lv 1 6 pts. 8,988
  9. Avatar for pandapharmd 99. pandapharmd Lv 1 6 pts. 8,983
  10. Avatar for ecali 100. ecali Lv 1 5 pts. 8,969

Comments