Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,170
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,943
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,931
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,710
  6. Avatar for freefolder 16. freefolder 1 pt. 8,653
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,629
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,579
  9. Avatar for CureCoin 19. CureCoin 1 pt. 8,482
  1. Avatar for phi16 21. phi16 Lv 1 62 pts. 9,292
  2. Avatar for Blipperman 22. Blipperman Lv 1 61 pts. 9,289
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 59 pts. 9,289
  4. Avatar for pmdpmd 24. pmdpmd Lv 1 58 pts. 9,288
  5. Avatar for Timo van der Laan 25. Timo van der Laan Lv 1 56 pts. 9,287
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 55 pts. 9,283
  7. Avatar for g_b 27. g_b Lv 1 53 pts. 9,281
  8. Avatar for actiasluna 28. actiasluna Lv 1 52 pts. 9,280
  9. Avatar for hpaege 29. hpaege Lv 1 51 pts. 9,279
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 49 pts. 9,277

Comments