1176: Revisiting Puzzle 124: PDZ Domain

Closed since about 10 years ago

Summary

• Created: December 23, 2015
• Expires: January 06, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

• 1. Contenders 100 pts. 9,453
• 2. Go Science 76 pts. 9,443
• 3. Beta Folders 56 pts. 9,415
• 4. Anthropic Dreams 41 pts. 9,376
• 5. Gargleblasters 29 pts. 9,340
• 6. L'Alliance Francophone 20 pts. 9,297
• 7. Void Crushers 14 pts. 9,287
• 8. HMT heritage 9 pts. 9,255
• 9. BOINC@Poland 6 pts. 9,250
• 10. Deleted group pts. 9,228

Top soloists

• 21. phi16 62 pts. 9,292
• 22. Blipperman 61 pts. 9,289
• 23. dcrwheeler 59 pts. 9,289
• 24. pmdpmd 58 pts. 9,288
• 25. Timo van der Laan 56 pts. 9,287
• 26. Bletchley Park 55 pts. 9,283
• 27. g_b 53 pts. 9,281
• 28. actiasluna 52 pts. 9,280
• 29. hpaege 51 pts. 9,279
• 30. christioanchauvin 49 pts. 9,277