Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228
  1. Avatar for Mydogisa Toelicker 111. Mydogisa Toelicker Lv 1 3 pts. 8,924
  2. Avatar for jebbiek 112. jebbiek Lv 1 3 pts. 8,923
  3. Avatar for Festering Wounds 113. Festering Wounds Lv 1 3 pts. 8,923
  4. Avatar for Jim Fraser 114. Jim Fraser Lv 1 3 pts. 8,921
  5. Avatar for PrettyPony2001 115. PrettyPony2001 Lv 1 3 pts. 8,917
  6. Avatar for Colostomy EXPLOSION. 116. Colostomy EXPLOSION. Lv 1 3 pts. 8,916
  7. Avatar for bwkittitas 117. bwkittitas Lv 1 3 pts. 8,908
  8. Avatar for arginia 118. arginia Lv 1 3 pts. 8,908
  9. Avatar for rezaefar 119. rezaefar Lv 1 3 pts. 8,907
  10. Avatar for Soggy Doglog 120. Soggy Doglog Lv 1 2 pts. 8,906

Comments