Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228
  1. Avatar for Skippysk8s 11. Skippysk8s Lv 1 80 pts. 9,331
  2. Avatar for gmn 12. gmn Lv 1 78 pts. 9,330
  3. Avatar for gitwut 13. gitwut Lv 1 76 pts. 9,329
  4. Avatar for johnmitch 14. johnmitch Lv 1 74 pts. 9,327
  5. Avatar for frood66 15. frood66 Lv 1 72 pts. 9,315
  6. Avatar for sheerbliss 16. sheerbliss Lv 1 71 pts. 9,312
  7. Avatar for KarenCH 17. KarenCH Lv 1 69 pts. 9,310
  8. Avatar for tony46 18. tony46 Lv 1 67 pts. 9,307
  9. Avatar for pauldunn 19. pauldunn Lv 1 65 pts. 9,307
  10. Avatar for nicobul 20. nicobul Lv 1 64 pts. 9,297

Comments