Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,061
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,042
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 8,672
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,102
  6. Avatar for Deleted group 16. Deleted group pts. 7,610
  7. Avatar for EVHS AP Biology 17. EVHS AP Biology 1 pt. 5,276
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 4,910
  1. Avatar for thkl 181. thkl Lv 1 1 pt. 7,176
  2. Avatar for metafolder 182. metafolder Lv 1 1 pt. 7,165
  3. Avatar for bcmccjr01 183. bcmccjr01 Lv 1 1 pt. 7,073
  4. Avatar for pandabearsecond 184. pandabearsecond Lv 1 1 pt. 6,921
  5. Avatar for Morpheox 185. Morpheox Lv 1 1 pt. 6,907
  6. Avatar for brgreening 186. brgreening Lv 1 1 pt. 6,885
  7. Avatar for Cerzax 187. Cerzax Lv 1 1 pt. 6,885
  8. Avatar for gruener-zwer 188. gruener-zwer Lv 1 1 pt. 6,869
  9. Avatar for SALiquidSilver 189. SALiquidSilver Lv 1 1 pt. 6,813
  10. Avatar for RJ Shirey 190. RJ Shirey Lv 1 1 pt. 6,489

Comments