Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,061
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,042
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 8,672
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,102
  6. Avatar for Deleted group 16. Deleted group pts. 7,610
  7. Avatar for EVHS AP Biology 17. EVHS AP Biology 1 pt. 5,276
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 4,910
  1. Avatar for BrKapr 81. BrKapr Lv 1 12 pts. 9,021
  2. Avatar for smilingone 82. smilingone Lv 1 11 pts. 9,017
  3. Avatar for Colostomy EXPLOSION. 83. Colostomy EXPLOSION. Lv 1 11 pts. 8,996
  4. Avatar for Psych0Active 84. Psych0Active Lv 1 11 pts. 8,983
  5. Avatar for Soggy Doglog 85. Soggy Doglog Lv 1 10 pts. 8,979
  6. Avatar for bendbob 86. bendbob Lv 1 10 pts. 8,978
  7. Avatar for NameChangeNeeded01 87. NameChangeNeeded01 Lv 1 10 pts. 8,949
  8. Avatar for Merf 88. Merf Lv 1 9 pts. 8,940
  9. Avatar for manu8170 89. manu8170 Lv 1 9 pts. 8,939
  10. Avatar for Festering Wounds 90. Festering Wounds Lv 1 9 pts. 8,932

Comments