Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326
  1. Avatar for BrKapr 81. BrKapr Lv 1 12 pts. 9,021
  2. Avatar for smilingone 82. smilingone Lv 1 11 pts. 9,017
  3. Avatar for Colostomy EXPLOSION. 83. Colostomy EXPLOSION. Lv 1 11 pts. 8,996
  4. Avatar for Psych0Active 84. Psych0Active Lv 1 11 pts. 8,983
  5. Avatar for Soggy Doglog 85. Soggy Doglog Lv 1 10 pts. 8,979
  6. Avatar for bendbob 86. bendbob Lv 1 10 pts. 8,978
  7. Avatar for NameChangeNeeded01 87. NameChangeNeeded01 Lv 1 10 pts. 8,949
  8. Avatar for Merf 88. Merf Lv 1 9 pts. 8,940
  9. Avatar for manu8170 89. manu8170 Lv 1 9 pts. 8,939
  10. Avatar for Festering Wounds 90. Festering Wounds Lv 1 9 pts. 8,932

Comments