Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,904
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,767
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,728
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,541
  5. Avatar for xkcd 15. xkcd 1 pt. 8,365
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,293
  7. Avatar for Team Germany 17. Team Germany 1 pt. 8,256
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,162
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 7,881

  1. Avatar for Ofelya 141. Ofelya Lv 1 2 pts. 8,615
  2. Avatar for phi16 142. phi16 Lv 1 2 pts. 8,612
  3. Avatar for penteplayer 143. penteplayer Lv 1 2 pts. 8,610
  4. Avatar for pfirth 144. pfirth Lv 1 2 pts. 8,601
  5. Avatar for Iron pet 145. Iron pet Lv 1 2 pts. 8,601
  6. Avatar for alwen 146. alwen Lv 1 2 pts. 8,595
  7. Avatar for metafolder 147. metafolder Lv 1 2 pts. 8,589
  8. Avatar for DrTree 148. DrTree Lv 1 1 pt. 8,577
  9. Avatar for senor pit 149. senor pit Lv 1 1 pt. 8,576
  10. Avatar for Maru67 150. Maru67 Lv 1 1 pt. 8,554

Comments