Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,904
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,767
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,728
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,541
  5. Avatar for xkcd 15. xkcd 1 pt. 8,365
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,293
  7. Avatar for Team Germany 17. Team Germany 1 pt. 8,256
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,162
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 7,881
  1. Avatar for drumpeter18yrs9yrs 211. drumpeter18yrs9yrs Lv 1 1 pt. 8,173
  2. Avatar for jakestrick 212. jakestrick Lv 1 1 pt. 8,171
  3. Avatar for thkl 213. thkl Lv 1 1 pt. 8,167
  4. Avatar for przemek112233 214. przemek112233 Lv 1 1 pt. 8,167
  5. Avatar for Mike Lewis 215. Mike Lewis Lv 1 1 pt. 8,164
  6. Avatar for doctaven 216. doctaven Lv 1 1 pt. 8,162
  7. Avatar for mvronsky 217. mvronsky Lv 1 1 pt. 8,158
  8. Avatar for odd135 218. odd135 Lv 1 1 pt. 8,156
  9. Avatar for bhodg1 219. bhodg1 Lv 1 1 pt. 8,128
  10. Avatar for Fowardint 220. Fowardint Lv 1 1 pt. 8,121

Comments