Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for drumpeter18yrs9yrs 211. drumpeter18yrs9yrs Lv 1 1 pt. 8,173
  2. Avatar for jakestrick 212. jakestrick Lv 1 1 pt. 8,171
  3. Avatar for thkl 213. thkl Lv 1 1 pt. 8,167
  4. Avatar for przemek112233 214. przemek112233 Lv 1 1 pt. 8,167
  5. Avatar for Mike Lewis 215. Mike Lewis Lv 1 1 pt. 8,164
  6. Avatar for doctaven 216. doctaven Lv 1 1 pt. 8,162
  7. Avatar for mvronsky 217. mvronsky Lv 1 1 pt. 8,158
  8. Avatar for odd135 218. odd135 Lv 1 1 pt. 8,156
  9. Avatar for bhodg1 219. bhodg1 Lv 1 1 pt. 8,128
  10. Avatar for Fowardint 220. Fowardint Lv 1 1 pt. 8,121

Comments