Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,904
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,767
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,728
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,541
  5. Avatar for xkcd 15. xkcd 1 pt. 8,365
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,293
  7. Avatar for Team Germany 17. Team Germany 1 pt. 8,256
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,162
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 7,881
  1. Avatar for Jajaboman 231. Jajaboman Lv 1 1 pt. 7,881
  2. Avatar for Colton_Fox_77 232. Colton_Fox_77 Lv 1 1 pt. 7,869
  3. Avatar for jalhalla2010 233. jalhalla2010 Lv 1 1 pt. 7,837
  4. Avatar for Victor Tobiasson 234. Victor Tobiasson Lv 1 1 pt. 7,814
  5. Avatar for NK Dragon Engineer 235. NK Dragon Engineer Lv 1 1 pt. 7,789
  6. Avatar for zkm 236. zkm Lv 1 1 pt. 7,649
  7. Avatar for JMStiffler 237. JMStiffler Lv 1 1 pt. 7,228
  8. Avatar for UncivillizedFrog 238. UncivillizedFrog Lv 1 1 pt. 6,585
  9. Avatar for dettingen 239. dettingen Lv 1 1 pt. 6,585
  10. Avatar for emmaaberg 240. emmaaberg Lv 1 1 pt. 6,585

Comments