Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for Jajaboman 231. Jajaboman Lv 1 1 pt. 7,881
  2. Avatar for Colton_Fox_77 232. Colton_Fox_77 Lv 1 1 pt. 7,869
  3. Avatar for jalhalla2010 233. jalhalla2010 Lv 1 1 pt. 7,837
  4. Avatar for Victor Tobiasson 234. Victor Tobiasson Lv 1 1 pt. 7,814
  5. Avatar for NK Dragon Engineer 235. NK Dragon Engineer Lv 1 1 pt. 7,789
  6. Avatar for zkm 236. zkm Lv 1 1 pt. 7,649
  7. Avatar for JMStiffler 237. JMStiffler Lv 1 1 pt. 7,228
  8. Avatar for UncivillizedFrog 238. UncivillizedFrog Lv 1 1 pt. 6,585
  9. Avatar for dettingen 239. dettingen Lv 1 1 pt. 6,585
  10. Avatar for emmaaberg 240. emmaaberg Lv 1 1 pt. 6,585

Comments