Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,904
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,767
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,728
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,541
  5. Avatar for xkcd 15. xkcd 1 pt. 8,365
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,293
  7. Avatar for Team Germany 17. Team Germany 1 pt. 8,256
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,162
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 7,881
  1. Avatar for jobo0502 51. jobo0502 Lv 1 32 pts. 8,908
  2. Avatar for pandapharmd 52. pandapharmd Lv 1 31 pts. 8,907
  3. Avatar for stomjoh 53. stomjoh Lv 1 31 pts. 8,906
  4. Avatar for Anfinsen_slept_here 54. Anfinsen_slept_here Lv 1 30 pts. 8,904
  5. Avatar for tallguy-13088 55. tallguy-13088 Lv 1 29 pts. 8,901
  6. Avatar for hallenberg 56. hallenberg Lv 1 28 pts. 8,900
  7. Avatar for ViJay7019 57. ViJay7019 Lv 1 28 pts. 8,899
  8. Avatar for aznarog 58. aznarog Lv 1 27 pts. 8,895
  9. Avatar for hpaege 59. hpaege Lv 1 26 pts. 8,893
  10. Avatar for Idiotboy 60. Idiotboy Lv 1 26 pts. 8,893

Comments