Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for jobo0502 51. jobo0502 Lv 1 32 pts. 8,908
  2. Avatar for pandapharmd 52. pandapharmd Lv 1 31 pts. 8,907
  3. Avatar for stomjoh 53. stomjoh Lv 1 31 pts. 8,906
  4. Avatar for Anfinsen_slept_here 54. Anfinsen_slept_here Lv 1 30 pts. 8,904
  5. Avatar for tallguy-13088 55. tallguy-13088 Lv 1 29 pts. 8,901
  6. Avatar for hallenberg 56. hallenberg Lv 1 28 pts. 8,900
  7. Avatar for ViJay7019 57. ViJay7019 Lv 1 28 pts. 8,899
  8. Avatar for aznarog 58. aznarog Lv 1 27 pts. 8,895
  9. Avatar for hpaege 59. hpaege Lv 1 26 pts. 8,893
  10. Avatar for Idiotboy 60. Idiotboy Lv 1 26 pts. 8,893

Comments