Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,904
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,767
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,728
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,541
  5. Avatar for xkcd 15. xkcd 1 pt. 8,365
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,293
  7. Avatar for Team Germany 17. Team Germany 1 pt. 8,256
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,162
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 7,881
  1. Avatar for eusair 81. eusair Lv 1 14 pts. 8,844
  2. Avatar for SouperGenious 82. SouperGenious Lv 1 14 pts. 8,843
  3. Avatar for isaksson 83. isaksson Lv 1 13 pts. 8,843
  4. Avatar for cherry39 84. cherry39 Lv 1 13 pts. 8,840
  5. Avatar for guineapig 85. guineapig Lv 1 13 pts. 8,834
  6. Avatar for jamiexq 86. jamiexq Lv 1 12 pts. 8,833
  7. Avatar for pvc78 87. pvc78 Lv 1 12 pts. 8,833
  8. Avatar for Deleted player 88. Deleted player 12 pts. 8,827
  9. Avatar for YeshuaLives 89. YeshuaLives Lv 1 11 pts. 8,825
  10. Avatar for WBarme1234 90. WBarme1234 Lv 1 11 pts. 8,823

Comments