Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for eusair 81. eusair Lv 1 14 pts. 8,844
  2. Avatar for SouperGenious 82. SouperGenious Lv 1 14 pts. 8,843
  3. Avatar for isaksson 83. isaksson Lv 1 13 pts. 8,843
  4. Avatar for cherry39 84. cherry39 Lv 1 13 pts. 8,840
  5. Avatar for guineapig 85. guineapig Lv 1 13 pts. 8,834
  6. Avatar for jamiexq 86. jamiexq Lv 1 12 pts. 8,833
  7. Avatar for pvc78 87. pvc78 Lv 1 12 pts. 8,833
  8. Avatar for Deleted player 88. Deleted player 12 pts. 8,827
  9. Avatar for YeshuaLives 89. YeshuaLives Lv 1 11 pts. 8,825
  10. Avatar for WBarme1234 90. WBarme1234 Lv 1 11 pts. 8,823

Comments