Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for przemek112233 121. przemek112233 Lv 1 3 pts. 8,455
  2. Avatar for froggs554 122. froggs554 Lv 1 3 pts. 8,430
  3. Avatar for SKSbell 123. SKSbell Lv 1 3 pts. 8,425
  4. Avatar for Jim Fraser 124. Jim Fraser Lv 1 3 pts. 8,421
  5. Avatar for asperger1993 125. asperger1993 Lv 1 3 pts. 8,408
  6. Avatar for YGK 126. YGK Lv 1 3 pts. 8,397
  7. Avatar for bwkittitas 127. bwkittitas Lv 1 2 pts. 8,396
  8. Avatar for proteansoup 128. proteansoup Lv 1 2 pts. 8,387
  9. Avatar for nagistick 129. nagistick Lv 1 2 pts. 8,374
  10. Avatar for Mr_Jolty 130. Mr_Jolty Lv 1 2 pts. 8,361

Comments