Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830

  1. Avatar for przemek112233 121. przemek112233 Lv 1 3 pts. 8,455
  2. Avatar for froggs554 122. froggs554 Lv 1 3 pts. 8,430
  3. Avatar for SKSbell 123. SKSbell Lv 1 3 pts. 8,425
  4. Avatar for Jim Fraser 124. Jim Fraser Lv 1 3 pts. 8,421
  5. Avatar for asperger1993 125. asperger1993 Lv 1 3 pts. 8,408
  6. Avatar for YGK 126. YGK Lv 1 3 pts. 8,397
  7. Avatar for bwkittitas 127. bwkittitas Lv 1 2 pts. 8,396
  8. Avatar for proteansoup 128. proteansoup Lv 1 2 pts. 8,387
  9. Avatar for nagistick 129. nagistick Lv 1 2 pts. 8,374
  10. Avatar for Mr_Jolty 130. Mr_Jolty Lv 1 2 pts. 8,361

Comments