Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for fishercat 131. fishercat Lv 1 2 pts. 8,353
  2. Avatar for SergiRoda 132. SergiRoda Lv 1 2 pts. 8,342
  3. Avatar for franse 133. franse Lv 1 2 pts. 8,323
  4. Avatar for zo3xiaJonWeinberg 134. zo3xiaJonWeinberg Lv 1 2 pts. 8,322
  5. Avatar for Maru67 135. Maru67 Lv 1 2 pts. 8,310
  6. Avatar for ecali 136. ecali Lv 1 2 pts. 8,310
  7. Avatar for WBarme1234 137. WBarme1234 Lv 1 2 pts. 8,305
  8. Avatar for bhodg1 138. bhodg1 Lv 1 2 pts. 8,298
  9. Avatar for SouperGenious 139. SouperGenious Lv 1 2 pts. 8,298
  10. Avatar for DAMilwaukeeWisconsin 140. DAMilwaukeeWisconsin Lv 1 2 pts. 8,261

Comments