Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830
  1. Avatar for fishercat 131. fishercat Lv 1 2 pts. 8,353
  2. Avatar for SergiRoda 132. SergiRoda Lv 1 2 pts. 8,342
  3. Avatar for franse 133. franse Lv 1 2 pts. 8,323
  4. Avatar for zo3xiaJonWeinberg 134. zo3xiaJonWeinberg Lv 1 2 pts. 8,322
  5. Avatar for Maru67 135. Maru67 Lv 1 2 pts. 8,310
  6. Avatar for ecali 136. ecali Lv 1 2 pts. 8,310
  7. Avatar for WBarme1234 137. WBarme1234 Lv 1 2 pts. 8,305
  8. Avatar for bhodg1 138. bhodg1 Lv 1 2 pts. 8,298
  9. Avatar for SouperGenious 139. SouperGenious Lv 1 2 pts. 8,298
  10. Avatar for DAMilwaukeeWisconsin 140. DAMilwaukeeWisconsin Lv 1 2 pts. 8,261

Comments