Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for MaartenDesnouck 171. MaartenDesnouck Lv 1 1 pt. 7,801
  2. Avatar for Jaco van As 172. Jaco van As Lv 1 1 pt. 7,706
  3. Avatar for DrTree 173. DrTree Lv 1 1 pt. 7,701
  4. Avatar for Tubby 174. Tubby Lv 1 1 pt. 7,677
  5. Avatar for marie.c 175. marie.c Lv 1 1 pt. 7,672
  6. Avatar for Radeodem8 176. Radeodem8 Lv 1 1 pt. 7,658
  7. Avatar for Fowardint 177. Fowardint Lv 1 1 pt. 7,654
  8. Avatar for Spiritic 178. Spiritic Lv 1 1 pt. 7,581
  9. Avatar for nvarius 179. nvarius Lv 1 1 pt. 7,543
  10. Avatar for lRensl 180. lRensl Lv 1 1 pt. 7,527

Comments