Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956

  1. Avatar for uhuuhu 41. uhuuhu Lv 1 39 pts. 8,903
  2. Avatar for Seagat2011 42. Seagat2011 Lv 1 38 pts. 8,894
  3. Avatar for smilingone 43. smilingone Lv 1 37 pts. 8,893
  4. Avatar for diamond_dust 44. diamond_dust Lv 1 36 pts. 8,883
  5. Avatar for gcm24 45. gcm24 Lv 1 35 pts. 8,881
  6. Avatar for pauldunn 46. pauldunn Lv 1 35 pts. 8,860
  7. Avatar for tarimo 47. tarimo Lv 1 34 pts. 8,855
  8. Avatar for reefyrob 48. reefyrob Lv 1 33 pts. 8,849
  9. Avatar for christioanchauvin 49. christioanchauvin Lv 1 32 pts. 8,848
  10. Avatar for rasergio 50. rasergio Lv 1 31 pts. 8,837

Comments