Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830
  1. Avatar for uhuuhu 41. uhuuhu Lv 1 39 pts. 8,903
  2. Avatar for Seagat2011 42. Seagat2011 Lv 1 38 pts. 8,894
  3. Avatar for smilingone 43. smilingone Lv 1 37 pts. 8,893
  4. Avatar for diamond_dust 44. diamond_dust Lv 1 36 pts. 8,883
  5. Avatar for gcm24 45. gcm24 Lv 1 35 pts. 8,881
  6. Avatar for pauldunn 46. pauldunn Lv 1 35 pts. 8,860
  7. Avatar for tarimo 47. tarimo Lv 1 34 pts. 8,855
  8. Avatar for reefyrob 48. reefyrob Lv 1 33 pts. 8,849
  9. Avatar for christioanchauvin 49. christioanchauvin Lv 1 32 pts. 8,848
  10. Avatar for rasergio 50. rasergio Lv 1 31 pts. 8,837

Comments