Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for g_b 51. g_b Lv 1 30 pts. 8,837
  2. Avatar for weitzen 52. weitzen Lv 1 29 pts. 8,836
  3. Avatar for Vredeman 53. Vredeman Lv 1 29 pts. 8,830
  4. Avatar for kitek314_pl 54. kitek314_pl Lv 1 28 pts. 8,830
  5. Avatar for bamh 55. bamh Lv 1 27 pts. 8,827
  6. Avatar for isaksson 56. isaksson Lv 1 26 pts. 8,816
  7. Avatar for joremen 57. joremen Lv 1 26 pts. 8,815
  8. Avatar for BrKapr 58. BrKapr Lv 1 25 pts. 8,815
  9. Avatar for Mike Cassidy 59. Mike Cassidy Lv 1 24 pts. 8,806
  10. Avatar for pfirth 60. pfirth Lv 1 24 pts. 8,799

Comments