Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830

  1. Avatar for g_b 51. g_b Lv 1 30 pts. 8,837
  2. Avatar for weitzen 52. weitzen Lv 1 29 pts. 8,836
  3. Avatar for Vredeman 53. Vredeman Lv 1 29 pts. 8,830
  4. Avatar for kitek314_pl 54. kitek314_pl Lv 1 28 pts. 8,830
  5. Avatar for bamh 55. bamh Lv 1 27 pts. 8,827
  6. Avatar for isaksson 56. isaksson Lv 1 26 pts. 8,816
  7. Avatar for joremen 57. joremen Lv 1 26 pts. 8,815
  8. Avatar for BrKapr 58. BrKapr Lv 1 25 pts. 8,815
  9. Avatar for Mike Cassidy 59. Mike Cassidy Lv 1 24 pts. 8,806
  10. Avatar for pfirth 60. pfirth Lv 1 24 pts. 8,799

Comments